General Information

  • ID:  hor003375
  • Uniprot ID:  A0A158TFP8
  • Protein name:  Orcokinin
  • Gene name:  ORCK
  • Organism:  Cancer borealis (Jonah crab)
  • Family:  Orcokinin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Cancer (genus), Cancridae (family), Cancroidea (superfamily), Heterotremata, Eubrachyura, Brachyura (infraorder), Pleocyemata (suborder), Decapoda (order), Eucarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  NA

Sequence Information

  • Sequence:  NFDEIDRSGF
  • Length:  10
  • Propeptide:  MTRDVICTALLLALCVMASEGAIKDTPTHPANQPDAGYPADGSAAKRFDAFTTGFGHSKRNFDEIDRSGFGFAKRNFDEIDRSGFGFAKRNFDEIDRSGFGFAKRNFDEIDRSGFGFAKRNFDEIDRSSFGFNKRNFDEIDRSSFGFVKRMLTPRDLANLYKRNFDEIDRSGFGFVRRNAE
  • Signal peptide:  MTRDVICTALLLALCVMASEG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Myotropic
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A0A158TFP8-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor003375_AF2.pdbhor003375_ESM.pdb

Physical Information

Mass: 135995 Formula: C52H74N14O19
Absent amino acids: ACHKLMPQTVWY Common amino acids: DF
pI: 3.88 Basic residues: 1
Polar residues: 3 Hydrophobic residues: 3
Hydrophobicity: -96 Boman Index: -3739
Half-Life: 1.4 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 39
Instability Index: 6197 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  16214114
  • Title:  Identification of Neuropeptides From the Decapod Crustacean Sinus Glands Using Nanoscale Liquid Chromatography Tandem Mass Spectrometry